DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Ctrb1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:222 Identity:69/222 - (31%)
Similarity:112/222 - (50%) Gaps:15/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSN 105
            :|:||.|..:..:.   .|||:|:.:.|::||.||  ||...||.:..:..:.::.....||:..
Mouse    45 WPWQVSLQDRTGFH---FCGGSLISENWVVTAAHC--GVKTTDVVVAGEFDQGSDEENVQVLKIA 104

  Fly   106 KFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQF-AGMSVVASGWGAMV--EM 167
            :...:.:||..|..|||.|:||.....|:..:....||:  ..|.| ||.....:|||...  .:
Mouse   105 QVFKNPKFNSFTVRNDITLLKLATPAQFSETVSAVCLPT--VDDDFPAGTLCATTGWGKTKYNAL 167

  Fly   168 TNSDSMQYTELKVISNAECAQEY-DVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQI--VVGIT 229
            ...|.:|...|.::|.|:|.:.: ..:|..:||| |....:.|.||||||||.:...:  :.||.
Mouse   168 KTPDKLQQAALPIVSEAKCKESWGSKITDVMICA-GASGVSSCMGDSGGPLVCQKDGVWTLAGIV 231

  Fly   230 SFGPADGCETNIPGGFTRVTHYLDWIE 256
            |:| :..|.|:.|..:.|||..:.|::
Mouse   232 SWG-SGFCSTSTPAVYARVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/222 (31%)
Tryp_SPc 37..255 CDD:214473 68/219 (31%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 68/219 (31%)
Tryp_SPc 34..259 CDD:238113 69/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.