DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG34171

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:240 Identity:63/240 - (26%)
Similarity:96/240 - (40%) Gaps:58/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGTLLDKRWILTAGHCTMGVTHYD-VYLGTK--------SVEDTEVSGGLVLRSNKFIVHERFN 114
            |.|.:|..|.:||:.||   :|..: |.:..|        |:..|..|...|:..:..|:|..::
  Fly    57 CTGVILTNRHVLTSAHC---ITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYH 118

  Fly   115 PETAANDIALVKLPQDVAFT-PRIQPASLPS-------------------RYRHDQFAGMSVVAS 159
             ....||||::||.:.|... ..:.|..|.:                   |.|...|..|.:|  
  Fly   119 -RNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLV-- 180

  Fly   160 GWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQI 224
                .||:...|..    |||..:...|:..:   ..:||.|. .::.:||.|.||||.. |.|:
  Fly   181 ----NVELRPFDEC----LKVKKSLMAARPEN---EDLICVKS-TEKQMCTTDFGGPLFC-DGQL 232

  Fly   225 VVGITSFGPADG---CETNIPGGFTRVTHYLDWIESKIGSHGQVH 266
                  :|.|.|   |.:..|..|:.|:.|..|: :||.|....|
  Fly   233 ------YGIALGSINCSSPDPVFFSDVSFYNSWV-TKIISEAVDH 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 59/230 (26%)
Tryp_SPc 37..255 CDD:214473 58/227 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 58/227 (26%)
Tryp_SPc 38..263 CDD:304450 59/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.