DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and PRSS8

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:272 Identity:83/272 - (30%)
Similarity:132/272 - (48%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTH---YDVYLGTKSV----EDTEVS 97
            ::|:||.:..:.:.    :|||:|:.::|:|:|.||.....|   |:|.||...:    ||.:||
Human    55 QWPWQVSITYEGVH----VCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVS 115

  Fly    98 GGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFA-GMSVVASGW 161
               .|:.  .|.|..:..|.:..||||::|.:.:.|:..|:|..||:  .:..|. |:....:||
Human   116 ---TLKD--IIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPA--ANASFPNGLHCTVTGW 173

  Fly   162 GAM---VEMTNSDSMQYTELKVISNAECAQEYDV---------VTSGVICA---KGLKDETVCTG 211
            |.:   |.:.....:|..|:.:||...|...|::         |...::||   :|.||  .|.|
Human   174 GHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKD--ACQG 236

  Fly   212 DSGGPL--VLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHGQVHQQYLRPQQ 274
            ||||||  .::....:.||.|:|.|.|.. |.||.:|..:.|..||:||:..    .|..:.||.
Human   237 DSGGPLSCPVEGLWYLTGIVSWGDACGAR-NRPGVYTLASSYASWIQSKVTE----LQPRVVPQT 296

  Fly   275 QHHHHQYSDNNL 286
            |   ....|:||
Human   297 Q---ESQPDSNL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 74/242 (31%)
Tryp_SPc 37..255 CDD:214473 72/239 (30%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 72/239 (30%)
Tryp_SPc 45..284 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.