DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and ctrb.3

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:252 Identity:84/252 - (33%)
Similarity:127/252 - (50%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SKYGRI--------EKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLG-- 87
            |.|.||        ..:|:||.|   |.:.....|||:|:::.|::||.||::..:| .|.||  
Zfish    29 SGYARIVNGEEAVPHSWPWQVSL---QDFTGFHFCGGSLINEFWVVTAAHCSVRTSH-RVILGEH 89

  Fly    88 ----TKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRH 148
                :.:.||.:     .::.:|...|.::|..|..||||||||....:....:.|..|..  ..
Zfish    90 NKGKSNTQEDIQ-----TMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLAE--AS 147

  Fly   149 DQFA-GMSVVASGWGAMVEMTNS----DSMQYTELKVISNAECAQEY-DVVTSGVICAKGLKDET 207
            |.|| ||:.|.||||  |...|:    |.:|...|.::||.:|...: ..:...:||| |....:
Zfish   148 DNFASGMTCVTSGWG--VTRYNALFTPDELQQVALPLLSNEDCKNHWGSNIRDTMICA-GAAGAS 209

  Fly   208 VCTGDSGGPLVLKDTQI--VVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSH 262
            .|.||||||||.:...|  :|||.|:| :..|:..:||.:.|||...||::..:.|:
Zfish   210 SCMGDSGGPLVCQKDNIWTLVGIVSWG-SSRCDPTMPGVYGRVTELRDWVDQILASN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 81/242 (33%)
Tryp_SPc 37..255 CDD:214473 80/239 (33%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 80/239 (33%)
Tryp_SPc 34..261 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.