DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:264 Identity:80/264 - (30%)
Similarity:120/264 - (45%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PTDSYAVGQSKYGRIEKFPYQVML-IGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLG 87
            |.:....||...|  .|:|:||.| :....|..  .|||:|:..:|:|||.||          :|
  Rat    62 PREGIVGGQEASG--NKWPWQVSLRVNDTYWMH--FCGGSLIHPQWVLTAAHC----------VG 112

  Fly    88 TKSVEDTEVSGGL----------VLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASL 142
            ....:..::...|          :|..::.|.|..|.......||||:||...|..|..:...||
  Rat   113 PNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSL 177

  Fly   143 PSRYRHDQF-AGMSVVASGWGAMVEMTNSD-------SMQYTELKVISNAECAQEY--------- 190
            |.  ..:.| :|.....:|||.:    |:|       .::..::.::.|..|..:|         
  Rat   178 PP--ASETFPSGTLCWVTGWGNI----NNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDN 236

  Fly   191 -DVVTSGVICAKGLKDETVCTGDSGGPLVLK--DTQIVVGITSFGPADGC-ETNIPGGFTRVTHY 251
             .:|...::|| |.:....|.||||||||.|  ||.:..|:.|:|  :|| :.|.||.:||||:|
  Rat   237 VHIVRDDMLCA-GNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWG--EGCAQPNRPGIYTRVTYY 298

  Fly   252 LDWI 255
            ||||
  Rat   299 LDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 76/251 (30%)
Tryp_SPc 37..255 CDD:214473 74/249 (30%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 77/258 (30%)
Tryp_SPc 66..302 CDD:238113 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.