DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CTRB2

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:228 Identity:76/228 - (33%)
Similarity:115/228 - (50%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSN 105
            :|:||.|..|..:.   .|||:|:.:.|::||.||  ||...||.:..:..:.::.....||:..
Human    45 WPWQVSLQDKTGFH---FCGGSLISEDWVVTAAHC--GVRTSDVVVAGEFDQGSDEENIQVLKIA 104

  Fly   106 KFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQF-AGMSVVASGWGAMVEMTN 169
            |...:.:|:..|..|||.|:||.....|:..:....|||  ..|.| ||.....:|||......|
Human   105 KVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS--ADDDFPAGTLCATTGWGKTKYNAN 167

  Fly   170 S--DSMQYTELKVISNAECAQEYD-VVTSGVICAKGLKDETVCTGDSGGPLVL-KD-TQIVVGIT 229
            .  |.:|...|.::|||||.:.:. .:|..:||| |....:.|.||||||||. || ...:|||.
Human   168 KTPDKLQQAALPLLSNAECKKSWGRRITDVMICA-GASGVSSCMGDSGGPLVCQKDGAWTLVGIV 231

  Fly   230 SFGPADGCETNIPGGFTRVTHYLDWIESKIGSH 262
            |:| :..|.|..|..:.||...:.|::..:.::
Human   232 SWG-SRTCSTTTPAVYARVAKLIPWVQKILAAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 76/222 (34%)
Tryp_SPc 37..255 CDD:214473 75/219 (34%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 75/219 (34%)
Tryp_SPc 34..259 CDD:238113 76/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.