DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG9737

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:290 Identity:82/290 - (28%)
Similarity:118/290 - (40%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YG----RIEKFPYQVMLI------GKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYD------ 83
            ||    .:::||:..:|:      |         |.|.|:|.|.||||.||..|....|      
  Fly   151 YGGEIAELDEFPWLALLVYNSNDYG---------CSGALIDDRHILTAAHCVQGEGVRDRQGLKH 206

  Fly    84 VYLGTKSVEDTE------------VSGGLVLRSNKFIVHERFN--PETAANDIALVKLPQDVAFT 134
            |.||..:|: ||            ....|.:...|..||..:.  .....||||:::|...|:||
  Fly   207 VRLGEFNVK-TEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFT 270

  Fly   135 PRIQPASLPSRYRHDQFA-GMSVVASGWGAMVEMTNSDSMQ-YTELKV------ISNAECAQEYD 191
            ..:.|..||::......| |.....|||| ..::.|...:. ::.:|:      :||..|.:   
  Fly   271 HFVMPICLPNKSEPLTLAEGQMFSVSGWG-RTDLFNKYFINIHSPIKLKLRIPYVSNENCTK--- 331

  Fly   192 VVTSGV--------ICAKGLKDETVCTGDSGGPLVLKDTQ----IVVGITSFGPADGCETNIPGG 244
             :..|.        |||.|...:..|.|||||||:..|.|    :..|:.|:|.........|..
  Fly   332 -ILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAV 395

  Fly   245 FTRVTHYLDWIESKIGSHGQVHQQYLRPQQ 274
            :|.|..|.|||:|       |.||..:.||
  Fly   396 YTNVAEYTDWIDS-------VVQQRKKSQQ 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 74/266 (28%)
Tryp_SPc 37..255 CDD:214473 72/263 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 74/269 (28%)
Tryp_SPc 150..409 CDD:238113 77/279 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.