DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:250 Identity:86/250 - (34%)
Similarity:126/250 - (50%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KYGRIE------------KFPYQVMLIGKQL-------WRKRILCGGTLLDKRWILTAGHCTMGV 79
            ::|.||            :.||   ::|..|       |     |||:::...|:|||.|||.|.
  Fly    33 RHGGIEGRITNGNLASEGQVPY---IVGVSLNSNGNWWW-----CGGSIIGHTWVLTAAHCTAGA 89

  Fly    80 THYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPS 144
            ....:|.|  :|...|.:....:.|..||.:..:  ....:|:||:|.|. |.|...:....|||
  Fly    90 DEASLYYG--AVNYNEPAFRHTVSSENFIRYPHY--VGLDHDLALIKTPH-VDFYSLVNKIELPS 149

  Fly   145 -RYRHDQFAGMSVVASGWGAMVEMTN-SDSMQYTELKVISNAECAQEY--DVVTSGVICAKGLKD 205
             ..|::.:....|.|:||||:.:.:| .:.::..:|||||.|||...|  |..:...||.:....
  Fly   150 LDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDG 214

  Fly   206 ETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260
            :..|.||||||||.|:...::|||||..|.||:...|.||||||.||:||:.:.|
  Fly   215 KATCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 84/243 (35%)
Tryp_SPc 37..255 CDD:214473 82/240 (34%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 80/236 (34%)
Tryp_SPc 41..266 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.030

Return to query results.
Submit another query.