DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG11841

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:111/257 - (43%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EKFPYQVMLIGKQLWRKRI--LCGGTLLDKRWILTAGHC-----------TMGVTHYDVYLGTKS 90
            ::||:...| |.:.....|  .|||||:..|.:|||.||           .:|...:|.......
  Fly    81 KEFPFAARL-GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAE 144

  Fly    91 VEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLP--SRYRHDQFAG 153
            .||   .|.|.|::     |..|......|||.:|:|.::|.|.....||.||  ...:|:.|  
  Fly   145 PED---FGVLALKA-----HPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESF-- 199

  Fly   154 MSVVASGWG----AMVEMTNSDSMQYTELK------VISNAECAQEYDVVTSGVICAKGLKDETV 208
               :|.|||    |..|......:|....|      |.:|.|....|:  ....:|.....::..
  Fly   200 ---IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYE--PKSQLCIGSRDNKDT 259

  Fly   209 CTGDSGGPLVL--KDTQI---VVGITSFGPADGCET-NIPGGFTRVTHYLDWIESKIGSHGQ 264
            |.||||||::.  ||...   |:||||.|..  |.| :||..:|||.::|:||:.::....|
  Fly   260 CNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIPSAYTRVHYFLNWIKGELAKQTQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 76/249 (31%)
Tryp_SPc 37..255 CDD:214473 74/246 (30%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 75/247 (30%)
Tryp_SPc 72..310 CDD:214473 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.