DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG10232

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:120/281 - (42%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YAVGQSKYGRIEKFPYQVMLI--GKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKS 90
            |.:......|..::|:..|||  .::|......|.|:|::||::|||.||.              
  Fly   255 YRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCV-------------- 305

  Fly    91 VEDTEVSGGLVLRSNK-----------------------------FIVHER-FNPETAANDIALV 125
            |:|..|:..||||..:                             |.|||: ||.....:|||||
  Fly   306 VKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALV 370

  Fly   126 KLPQDVAFTPRIQPASLPS----RYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAEC 186
            :|...|.:|..|.|..:|.    .:.|      .:..:|||      .:.:.:|::: ::.|...
  Fly   371 RLQTPVRYTHEILPICVPKDPIPLHNH------PLQIAGWG------YTKNREYSQV-LLHNTVY 422

  Fly   187 AQEY---DVVT----SGVICAKGLKDETVCTGDSGGPLVL------KDTQIVVGITSFGPADGCE 238
            ...|   |.::    ...|||.|::.|..|.|||||||:|      :|...:.||.|:| ::.|.
  Fly   423 ENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYG-SENCG 486

  Fly   239 TNIPGGFTRVTHYLDWIESKI 259
            ...||.:|:...:..||::.:
  Fly   487 DRKPGVYTKTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/269 (27%)
Tryp_SPc 37..255 CDD:214473 71/266 (27%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 73/273 (27%)
Tryp_SPc 260..503 CDD:214473 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.