DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and SPE

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:301 Identity:84/301 - (27%)
Similarity:139/301 - (46%) Gaps:62/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LMMWKPTPTDSYAVGQSK----------------YG----RIEKFPYQVMLIGKQLWRKRIL--C 59
            :|..:|||:...|:.|..                :|    .:.:||:.|:|..|:|:.:...  |
  Fly   102 IMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNC 166

  Fly    60 GGTLLDKRWILTAGHC-------TMGVTHYDVYLG---TKSVED--TEVSGGLV-------LRSN 105
            ||.||:.|::||||||       ..|...:.|.||   |::..|  |:::|..:       :...
  Fly   167 GGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVE 231

  Fly   106 KFIVHERFNPETA--ANDIALVKLPQDVAFTPRIQPASLPS-RYRHDQFAGMSVVASGWGAMVEM 167
            |.|:||.:.|.:.  .||||||:|.:.|::|..::|..||: ....:.|....:..:|||    :
  Fly   232 KGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWG----L 292

  Fly   168 TNSDSMQYTELKVISN----AECAQEYD----VVTSGVICAKGLKDETVCTGDSGGPLVL----- 219
            |.:......:||:..|    ..|.::|.    .:....:||.|......|.|||||||::     
  Fly   293 TENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTG 357

  Fly   220 -KDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259
             :|...:.|:||:|.........||.:||...::|||:.|:
  Fly   358 GRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 76/258 (29%)
Tryp_SPc 37..255 CDD:214473 74/255 (29%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 77/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.