DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG16710

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:115/264 - (43%) Gaps:65/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFPYQVMLI----GKQLWRKRIL--CGGTLLDKRWILTAGHCTMGVTHYD---VYLGTKSV---- 91
            :.|:..:::    .:.:|.:|::  |.|:|:..|::|||.|| :.:|..|   |.||..::    
  Fly   116 ELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHC-LRITGLDLRRVRLGEHNILSNP 179

  Fly    92 --------------EDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQP--A 140
                          |..|:...|.::...::|.|    |...|||||::|...|.:|.:|:|  .
  Fly   180 DCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFE----ERPYNDIALLRLKFPVRYTAQIKPICV 240

  Fly   141 SLPSRYRHDQFAGMSVVASGWG-------------AMVEMTNSDSMQYTELKVISNAECAQEYDV 192
            .|...:.:..|:...:..:|||             |.|...|:|....:|..:..:.|..     
  Fly   241 QLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSLGLDKETH----- 300

  Fly   193 VTSGVICAKGLKDETVCTGDSGGPLVL----KDTQIV--VGITSFGPADGCETNIPGGFTRVTHY 251
                 |||..|.....|.|||||||:.    .|.:.|  .||||:|.:. |... |..:|:.:.:
  Fly   301 -----ICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ-CGYG-PAAYTKTSKF 358

  Fly   252 LDWI 255
            ::||
  Fly   359 VEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 68/264 (26%)
Tryp_SPc 37..255 CDD:214473 66/262 (25%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 66/262 (25%)
Tryp_SPc 106..362 CDD:238113 66/262 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.