DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG31199

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:265 Identity:60/265 - (22%)
Similarity:99/265 - (37%) Gaps:50/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTM---GVTH-YDV 84
            ||:...|.:..||:  .|..::...|         |.|.|:.||.:|...||.:   ||.. :.|
  Fly    47 PTEHQWVARIVYGK--GFEGKIRDNG---------CLGVLVSKRTVLAPAHCFVQYNGVAEAFSV 100

  Fly    85 YLGTKS------VEDTEVSGGLV-----LRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQ 138
            :||..:      |...|..|..|     ::..:..:|..::..|..|.:|::.|.:|....|.:.
  Fly   101 HLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVM 165

  Fly   139 PASL-PSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYD--VVTSGVICA 200
            |..: |....::.....:.|.:|....     .|....|.:..:|...|..:..  |.:|..:| 
  Fly   166 PICMPPPSLLNETLVAQTFVVAGLRVF-----EDFRLKTWVNTLSRGFCQSKVKTLVTSSNTVC- 224

  Fly   201 KGLKDETVCTGDSGGPLV-------LKDTQIVVGITSFGPAD-GCETN-IPGGFTRVTHYLDWIE 256
             |...:.|.. ..|.|||       :.....:|||.    .| ..|.| |...|..:.:|:|:|.
  Fly   225 -GYHKQPVAY-YLGAPLVGLQKKGHVTQNYYLVGIM----IDWRWENNRIMSSFLAIRNYMDFIR 283

  Fly   257 SKIGS 261
            ....|
  Fly   284 QNSNS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 54/247 (22%)
Tryp_SPc 37..255 CDD:214473 53/244 (22%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 49/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.