DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG5246

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:229 Identity:66/229 - (28%)
Similarity:107/229 - (46%) Gaps:20/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PYQVMLI---GKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLR 103
            ||||.::   |:.      :|||:::..:|||||.||......| :.:.|.:|:.|......::.
  Fly    54 PYQVSIMNTFGEH------VCGGSIIAPQWILTAAHCMEWPIQY-LKIVTGTVDYTRPGAEYLVD 111

  Fly   104 SNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEMT 168
            .:|  :|...:.....|||||:...:.:.:....||..|.|:....: .|..:..:|||:.....
  Fly   112 GSK--IHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPK-VGDKLTLTGWGSTKTWG 173

  Fly   169 N-SDSMQYTELKVISNAEC---AQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGIT 229
            . |..:|..:|..|.:..|   .:..:.::.|.:|....:.|..|.|||||||| ...|.:||:.
  Fly   174 RYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-DANQTLVGVV 237

  Fly   230 SFGPADGCETNIPGGFTRVTHYLDWIESKIGSHG 263
            ::|.|  |....|..|..|.:|.||||..:...|
  Fly   238 NWGEA--CAIGYPDVFGSVAYYHDWIEQMMTDAG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 65/222 (29%)
Tryp_SPc 37..255 CDD:214473 62/219 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 62/219 (28%)
Tryp_SPc 42..263 CDD:238113 64/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.