DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and modSP

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:250 Identity:57/250 - (22%)
Similarity:86/250 - (34%) Gaps:59/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IGKQLWRK----RILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTK---SVEDTEVSGGLVLRSN 105
            :|..:|..    ...|||:||....::||.||.     ||.  ||:   |.:...|......|: 
  Fly   384 VGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCV-----YDE--GTRLPYSYDTFRVIAAKFYRN- 440

  Fly   106 KFIVHERFNPETAANDIALVKLP-----------QDVAFTPRIQPASL-----PSRYRHDQFAGM 154
                :....||....|:.|:::.           ||:|.....:|..|     |.......||..
  Fly   441 ----YGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEK 501

  Fly   155 SVVA-------SGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDETVCTGD 212
            ..|.       :||    .:.|...:|:......||:.|.:....:.:...|.........|.||
  Fly   502 ESVTDDVQGKFAGW----NIENKHELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGKSLACQGD 562

  Fly   213 SGG------PLVLKDT-----QIVVGITSFGP-ADGCETNIPGGFTRVTHYLDWI 255
            |||      |.....|     ..:.|:.|..| ||.|..::. ..|.:.|:.|.|
  Fly   563 SGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCAHSLT-VMTNIQHFEDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 56/249 (22%)
Tryp_SPc 37..255 CDD:214473 56/248 (23%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 56/248 (23%)
Tryp_SPc 371..591 CDD:304450 48/222 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.