DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG31326

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:296 Identity:79/296 - (26%)
Similarity:128/296 - (43%) Gaps:67/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PTPTDSYAVGQSKYGRIEKFPYQ------------------VMLIGKQLWRKRI----------- 57
            |.|:.|.|..|:....::..|.|                  ::..||.|.|.::           
  Fly   232 PNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERASTTPLIFQGKSLQRGQLPWLVAIFERRE 296

  Fly    58 ------LCGGTLLDKRWILTAGHC------TMGVTHYDVYLGTKSV---EDTEVSGGLVLRSNKF 107
                  :|||||:....:|:|.||      .:..:...|.||..::   .|.|..|     .::.
  Fly   297 SNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRG-----VSQL 356

  Fly   108 IVHERFN-PETAANDIALVKLPQDVAFTPRIQPASL-PSRYRHDQFAGMSVVASGWGAMVEMT-N 169
            |:||.|. .:....|:|||:|.:.|.:|..|.|..| .:..|.|...|:....:|||.....| |
  Fly   357 IIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGN 421

  Fly   170 SDSMQYTELKVISNAECAQE--YDVVTSGVICAKGLKDET---VCTGDSGGPLVLK--DTQIVVG 227
            ::..:.|:|.::|.|.||.|  :.:|....:|||    :|   .|..|.||||:|:  |..::.|
  Fly   422 TEVSKVTDLNIVSEANCALELPHVLVQPSSLCAK----KTGAGPCASDGGGPLMLREQDVWVLRG 482

  Fly   228 ITSFG----PADGCETNIPGGFTRVTHYLDWIESKI 259
            :.|.|    ..:.||.:.|..||.|..:::|:..|:
  Fly   483 VISGGVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/278 (26%)
Tryp_SPc 37..255 CDD:214473 72/275 (26%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 71/248 (29%)
Tryp_SPc 277..514 CDD:214473 70/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.