DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG8870

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:279 Identity:82/279 - (29%)
Similarity:123/279 - (44%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPTPTDSYAVGQSKYGRIEKFPYQVMLI--GKQLWRKRIL--CGGTLLDKRWILTAGHCTMGVTH 81
            |||        :.|...:.:||:..||:  .|....::::  |||:|::..::|||.||    ..
  Fly    83 KPT--------KGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHC----VE 135

  Fly    82 Y----------DVYLG---TKSVEDTEVSGG--------LVLRSNKFIVHERFN-PETAANDIAL 124
            |          .|.||   |.:..|..:..|        :.:..::.|.||:|| .....|||||
  Fly   136 YPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIAL 200

  Fly   125 VKLPQDVAFTPRIQPASLPSRYRHDQFAG--MSVVASGWGAMVEMTNSDSMQYTELKVISNAECA 187
            |:|...|.:|..|||..||   |..:.|.  ....||||..|.:...|:.:..:.:.......|.
  Fly   201 VRLKFPVRYTRAIQPICLP---RAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCK 262

  Fly   188 QEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQI--------VVGITSFGPADGC--ETNIP 242
            ..||......|||.||.......|||||||:  :|.|        ..||.|:|... |  :|..|
  Fly   263 SNYDFNLGSQICAGGLDGNDTSPGDSGGPLM--ETVIRGKVTLTYAAGIISYGQKP-CVLKTCKP 324

  Fly   243 GGFTRVTHYLDWIESKIGS 261
            ..:|:.:::.:||:||:.|
  Fly   325 AFYTKTSYFFEWIKSKLQS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 75/258 (29%)
Tryp_SPc 37..255 CDD:214473 73/255 (29%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/256 (29%)
Tryp_SPc 93..337 CDD:214473 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.