DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and snk

DIOPT Version :10

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_524338.2 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:78 Identity:19/78 - (24%)
Similarity:40/78 - (51%) Gaps:14/78 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLDVVISECATVFKL-LTGKDKPL----LIRRDSF-----LILDLS-LNIVNSIRTFN--LQSD 56
            ||..|::...:.:.:: :.|.|.|:    .:.::.|     ||...: ::|.|:|:...  :|::
  Fly   401 LLSKVMLKGLSAIPEVEMIGVDNPVELANRVYKNKFTPPTVLIFKYNYVSIKNAIQHHKDLIQNN 465

  Fly    57 DDLTSCAVT-KTL 68
            ||..:.|:. |||
  Fly   466 DDHDAIAIAEKTL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 11/36 (31%)
snkNP_524338.2 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.