DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and MP1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:231 Identity:73/231 - (31%)
Similarity:108/231 - (46%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVE-DTEVSGGLVLRSN----------KFIVHER 112
            |||:|::.|::|||.||...:.......|.:..| |...:....:..|          .:.|.||
  Fly   168 CGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEER 232

  Fly   113 F-------NPETAANDIALVKLPQDVAFTPRIQPASLPS-RYRHDQ-FAGMSVVASGWGAMVEMT 168
            .       |.....|||||::|..:|.::..|.|..||: ..:|:. |.|..||.:|||......
  Fly   233 IPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNF 297

  Fly   169 NSDSMQYTELKVISNAECAQEY----DVVTSGVICAKGLKDETVCTGDSGGPLVLKD------TQ 223
            .|:.....||..:..:||.|.|    ..||:..:||.|::....|.|||||||:|:|      ..
  Fly   298 TSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNY 362

  Fly   224 IVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259
            .:.|:.|:||........||.:|||..||:|||:.:
  Fly   363 YIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/228 (32%)
Tryp_SPc 37..255 CDD:214473 70/225 (31%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/225 (31%)
Tryp_SPc 138..397 CDD:238113 73/228 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.