DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG14088

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:233 Identity:67/233 - (28%)
Similarity:91/233 - (39%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RILCGGTLLDKRWILTAGHC--TMGVTHYDV----YLGTKSVEDTEVSGGLVLRSNKFIVHERFN 114
            ||:..|||:.:|:|||..||  ::||....:    .:|::..||..|:.        |..:..||
  Fly    55 RIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAA--------FFSNANFN 111

  Fly   115 PETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASG--WGAMVEMTNSDSMQYTE 177
            |||.||::.|:||.:.|.:...|.|..:....|...||......:|  |      .|||......
  Fly   112 PETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTW------KNSDKSPMLR 170

  Fly   178 LK-VISNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGIT-SFGPADGCETN 240
            .| ||...:...:.|   .|..|| |.||...|...||..|..:...|....| .||.|:..|..
  Fly   171 SKTVIRMPQACGKLD---HGQFCA-GHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVK 231

  Fly   241 IPGG--FTRVTHYLDWIESKIGS----------HGQVH 266
            ....  :|.|.....||...|.|          |...|
  Fly   232 CSNSRTYTDVVQLHQWISMVIYSSNTNDGMDKPHNTTH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 63/213 (30%)
Tryp_SPc 37..255 CDD:214473 61/210 (29%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 63/213 (30%)
Tryp_SPc 42..248 CDD:214473 61/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.