DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Jon74E

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:282 Identity:93/282 - (32%)
Similarity:131/282 - (46%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVIMLMMWKPTPTDSYAVGQSKYGRI--------EKFPYQVMLIGKQ-----LWRKRILCGGTL 63
            :.|.:|::.:........:|....|||        .:|||||.|..::     .|     ||.:|
  Fly     6 ILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCW-----CGASL 65

  Fly    64 LDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFI--------VHERFNPETAAN 120
            :..|::|||.||.........|||          |.|.|...:.|        :|..:|.::..|
  Fly    66 ISDRYLLTAAHCVEKAVAITYYLG----------GVLRLAPRQLIRSTNPEVHLHPDWNCQSLEN 120

  Fly   121 DIALVKLPQDVAFTPRIQPASLP----SRYRHDQFAGMSVVASGWGAMVEMTN--SDSMQYTELK 179
            |||||:||:|......|:|..||    ||..:|.   :..:|||||.|.:.:.  ||:::|....
  Fly   121 DIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDY---VPAIASGWGRMNDESTAISDNLRYVYRF 182

  Fly   180 VISNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLVLKD----TQIVVGITSFGPADGCETN 240
            |.||.:|...|..:....||......::.||||||||||..|    ..|::|:||:|...||...
  Fly   183 VESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKG 247

  Fly   241 IPGGFTRVTHYLDWIESKIGSH 262
            .|..|||:|.|||||....|.|
  Fly   248 YPSVFTRITAYLDWIGEVSGVH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 87/251 (35%)
Tryp_SPc 37..255 CDD:214473 85/248 (34%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.070

Return to query results.
Submit another query.