DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG3088

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:271 Identity:73/271 - (26%)
Similarity:128/271 - (47%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSIAHLLGLAVIMLMMWKPTPTDSYAV---------GQSKYGRIEKFPYQVMLIGKQLWRKRILC 59
            |.:...|||.::.....|....|...:         ||:.|           ::|....:..|.|
  Fly     2 KLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPY-----------VVGMAFGQSNIWC 55

  Fly    60 GGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIAL 124
            .||::...||||:..|..|.:...:|.|...:...:.:  :.:.:::::        |....:||
  Fly    56 SGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFT--VTVGTSEYV--------TGNQHLAL 110

  Fly   125 VKLPQDVAFTPRIQPASLPS-RYRHDQFAGMSVVASGWGAMVEMTN--SDSMQYTELKVISNAEC 186
            |::|: |.|:.|:...:||| |.|..::........||| :...:|  :|::|..:|:::||.||
  Fly   111 VRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWG-VTTFSNGLTDALQCVDLQIMSNNEC 173

  Fly   187 AQEY--DVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVT 249
            ...|  ..|:..::|.:.....:.|.||:|.||:.|....||||::|..::||...:|.||.|:|
  Fly   174 IAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARIT 238

  Fly   250 HYLDWIESKIG 260
            ..||||..:.|
  Fly   239 SALDWIHQRTG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 63/225 (28%)
Tryp_SPc 37..255 CDD:214473 61/222 (27%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 66/239 (28%)
Tryp_SPc 29..244 CDD:214473 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.