DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:271 Identity:92/271 - (33%)
Similarity:129/271 - (47%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMMWKPT--PTDSYAVGQSKYGRIE--------KFPYQVMLIGKQLWRKRILCGGTL 63
            :|.|||.....::..  |.|...|.:.: |||.        |.||.|.|.....|    .|||::
  Fly     7 ILALAVASASAYESVVHPKDLSKVAKIE-GRITNGYPAEEGKAPYTVGLGFSGGW----WCGGSI 66

  Fly    64 LDKRWILTAGHCTMG--VTHYDVYLGT---KSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIA 123
            :...|:|||.||..|  ||   ||.|.   .:.:.|...|     |..||.|       .:.|||
  Fly    67 ISNEWVLTAEHCIGGDAVT---VYFGATWRTNAQFTHWVG-----SGNFITH-------GSADIA 116

  Fly   124 LVKLPQDVAFTPRIQPASLPS-RYRHDQFAGMSVVASGWGAMVEMTN-SDSMQYTELKVISNAEC 186
            |:::|. |.|...:....||| ..|::.:.....||.|||...:.:. .|.:|..:|::|.|:||
  Fly   117 LIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC 180

  Fly   187 AQEYDVVTSG--VICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVT 249
            |..|...|.|  :||.:.:..:..|.||||||||..|...:||:|::....||:...|.||.|||
  Fly   181 ASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVT 245

  Fly   250 HYLDWIESKIG 260
            ::||||....|
  Fly   246 YHLDWIRDHTG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 83/237 (35%)
Tryp_SPc 37..255 CDD:214473 81/234 (35%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 81/234 (35%)
Tryp_SPc 37..254 CDD:238113 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.