DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG33465

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:292 Identity:67/292 - (22%)
Similarity:113/292 - (38%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IAHLLGLAVIMLMMWK------------PTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRIL 58
            ::.:|.||:|.|::.:            |..:::.   ...:|..|..|:...:..    ..:.:
  Fly     1 MSRVLSLALIGLVLCQGLAQLLDKKCHDPKTSENI---NFNHGATETAPWMASIYK----NNQFI 58

  Fly    59 CGGTLLDKRWILTAGHC---------TMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFN 114
            |.|||:.|.::|||..|         ..|:  |:.|.......:.|..|..|.     :.|..|.
  Fly    59 CDGTLVHKLFVLTAASCISKDSQLYVLFGM--YNQYRDASQFFNNEQYGVAVA-----LQHSNFR 116

  Fly   115 PETAANDIALVKLPQDVAFTPRIQP---------ASLPSRYRHDQFAGMSVVASGWGAMVEMTNS 170
            |....|||.|::|..:|.....|:|         .|.|    .::|.|.     ||.......:|
  Fly   117 PNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP----FERFEGF-----GWQQQGTEASS 172

  Fly   171 DSMQYTELKVISNAECAQEYDV--VTSGVICAKGLKDETVCTGDSGGPLV------LKDTQIVVG 227
            ...|...|......||.:...:  :..|..|| |.:|.:.|..:||.||.      :|:..:.||
  Fly   173 QVRQTVYLSQKKPFECHRNGQLLPINEGQFCA-GNRDRSFCRSNSGSPLTADFTYGVKNITVQVG 236

  Fly   228 ITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259
            :.|:|......|::   :|.|..:.|||.:.:
  Fly   237 LVSYGSELCSPTSV---YTDVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 60/246 (24%)
Tryp_SPc 37..255 CDD:214473 58/243 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 59/241 (24%)
Tryp_SPc 46..261 CDD:214473 57/238 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.