DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG10469

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:254 Identity:92/254 - (36%)
Similarity:136/254 - (53%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TDSYAVGQSKYGRIEKFPYQVMLI----GKQLWRKRILCGGTLLDKRWILTAGHCTM----GVTH 81
            |.|..:......:.::.||||.|:    |.:  .:..:||||:|..|||:||.||..    .:..
  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSK--DEPNMCGGTILSNRWIITAAHCLQDPKSNLWK 81

  Fly    82 YDVYLG-TKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSR 145
            ..:::| .||.:|.|:    |:..:..|||::|:.:|..|||||:|||:.:.|...||||.|||.
  Fly    82 VLIHVGKVKSFDDKEI----VVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA 142

  Fly   146 YRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYD---------VVTSGVIC-- 199
            .:  .:.|...:.||||...:...|..:||....:|||.||.::::         ||.:|.||  
  Fly   143 KK--TYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICID 205

  Fly   200 -AKGLKDETVCTGDSGGPLVLKD-TQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIE 256
             .|||.    |.||||||:||.| ::.:|||.|.|....|:..:|...|||:.||.||:
  Fly   206 SKKGLP----CRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 90/242 (37%)
Tryp_SPc 37..255 CDD:214473 88/239 (37%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 88/247 (36%)
Tryp_SPc 24..260 CDD:238113 89/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.