DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG6592

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:283 Identity:95/283 - (33%)
Similarity:145/283 - (51%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MMWKPTPTDSYAVGQ---SKYGRIEKFPYQVMLIGKQLWRKRIL--CGGTLLDKRWILTAGHCTM 77
            :|.|..|..:.|:.:   ...|....|||||   |..|.|.:.|  |||:|:..:.::||.||..
  Fly   108 LMEKMLPEGAMAMDRIFGGDVGNPHCFPYQV---GMLLQRPKGLYWCGGSLISDKHVITAAHCVD 169

  Fly    78 GVTHYDVYLGTKSVEDTEVSG--GLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPA 140
            ......|:||...:::.:..|  .|::.|..|.::..:||:...:|||:|:||..|:|..||.|.
  Fly   170 MAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI 234

  Fly   141 SLPSR-YRHDQFAGMSVVASGWGAMVEMTN--SDSMQYTELKVISNAECAQEYDVVTSGV-ICAK 201
            .||.| |.:..|.....:|||||......:  |:.::|.:|::|....|...:.:...|. ||..
  Fly   235 QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTS 299

  Fly   202 GLKDETVCTGDSGGPLVLK----DTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWI--ESKIG 260
            |....:.|.|||||||||:    ..:::|||||||...||:...|..||:|..|||||  |:.:.
  Fly   300 GRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVS 364

  Fly   261 SH---------GQVHQQYLRPQQ 274
            :|         .|..::|.:|:|
  Fly   365 AHQDTTEAIFFDQYVREYGKPRQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 85/234 (36%)
Tryp_SPc 37..255 CDD:214473 82/229 (36%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 83/237 (35%)
Tryp_SPc 123..359 CDD:238113 85/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
88.070

Return to query results.
Submit another query.