DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:272 Identity:89/272 - (32%)
Similarity:125/272 - (45%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMMWKPTPTDSYAVGQSKYGRIE--------KFPYQVMLI-------GKQLWRKRIL 58
            |.....::..:.:|.|......|....|||.        |.||.|.|.       |   |    .
  Fly     8 LFSAFALVAALERPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGGG---W----Y 65

  Fly    59 CGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIA 123
            |||:::...|:|||.|||.|.::            ..:|.|.|.|......|  ::.....||||
  Fly    66 CGGSIIGHEWVLTAAHCTYGASY------------VTISYGAVWRQQPQFTH--YDTGNLHNDIA 116

  Fly   124 LVKLPQDVAFTPRIQPASLPSRY--RHDQFAGMSVVASGWGAMVEMTN-SDSMQYTELKVISNAE 185
            |::.|. |.|...:....|| ||  |::.|.|...:.||||:..:.:. :|.:...::::..|:.
  Fly   117 LIRTPH-VDFWSLVNKVELP-RYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSV 179

  Fly   186 CAQEY--DVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRV 248
            |...|  ..:||..:|....:::..|:|||||||||.|....|||.|||.|.||.:|.|.|.|||
  Fly   180 CLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRV 244

  Fly   249 THYLDWIESKIG 260
            |.|||||....|
  Fly   245 TGYLDWIRDHTG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 83/240 (35%)
Tryp_SPc 37..255 CDD:214473 81/237 (34%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 81/237 (34%)
Tryp_SPc 37..254 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.