DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG10477

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:259 Identity:106/259 - (40%)
Similarity:142/259 - (54%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PTDSYAVGQSKYGRI--------EKFPYQVMLIGK----QLWRKRILCGGTLLDKRWILTAGHCT 76
            |.||.|| .|..|||        .:|||||.|..|    ..|     |||:::...|:|||.|||
  Fly    27 PRDSSAV-PSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWW-----CGGSIIANTWVLTAAHCT 85

  Fly    77 MGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPAS 141
            .|.:...:|.|  |...|.......:.|:||:.|..:|..|..|||:|:|.| .|.||..|...:
  Fly    86 KGASSVTIYYG--STVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTP-SVTFTVSINKIA 147

  Fly   142 LPS-RYRHDQFAGMSVVASGWGAMVEMTNSDS-------MQYTELKVISNAECAQEY--DVVTSG 196
            ||: ...:..:||.:.||||||     ..|||       :||.:.:||:||.|.:.:  .|||||
  Fly   148 LPAIASSYSTYAGQTAVASGWG-----RTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSG 207

  Fly   197 VICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260
            |||.:.:..::.|.|||||||.|.:.  ::|:|||..:.|||.|.|.||||||.|||||:::.|
  Fly   208 VICVESINKKSTCQGDSGGPLALNNR--LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQSG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 98/242 (40%)
Tryp_SPc 37..255 CDD:214473 96/239 (40%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 96/239 (40%)
Tryp_SPc 40..267 CDD:238113 97/241 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
98.970

Return to query results.
Submit another query.