DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG15873

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:93/218 - (42%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLR-----------SNKFIVH-- 110
            |.|.|:..|.:|||.||..     |.|..:.:.....|..|.:.|           .::.:||  
  Fly    69 CSGVLVSSRAVLTAAHCLT-----DRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPE 128

  Fly   111 -ERFNPETAANDIALVKLPQDVAFTPRIQPAS---LP--SRYRHDQFAGMSVVASGWGAMVEM-T 168
             ||:.    .||:|:::|.:      |:|.::   ||  .|...:...|.:.:..|||.:.:. .
  Fly   129 YERYK----KNDLAILRLSE------RVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQHGP 183

  Fly   169 NSDSMQYTELKVISNAECAQEYDVVTSG-VICAKGLKDETVCTGDSGGPLVLKDTQIVVGITSFG 232
            .|:.:.|.::.:...:.|.:.||..|:. .:|.:.:.:...|.||.||||:.|..  :.|:  .|
  Fly   184 YSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPLLCKGA--LFGL--IG 244

  Fly   233 PADGCETNIPGGFTRVTHYLDWI 255
            ...||.......|....:|.|||
  Fly   245 GHMGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 55/218 (25%)
Tryp_SPc 37..255 CDD:214473 53/216 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 49/199 (25%)
Tryp_SPc 59..250 CDD:238113 49/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.