DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG30283

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:236 Identity:71/236 - (30%)
Similarity:107/236 - (45%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNK 106
            |:..|::|:..:.    |||||:..|::||:.|| :......|.||....|         ..:.|
  Fly    55 PWMAMVMGEGGFH----CGGTLITNRFVLTSAHC-IANGELKVRLGVLERE---------AEAQK 105

  Fly   107 FIVHERF---NPETAANDIALVKLPQDVAFTPRIQPASL---PSRYRHDQFAGMSVVASGWGAMV 165
            |.|...|   :.....:|:||::|.:.|.::..|.|..|   |.....|:.. :.....|||...
  Fly   106 FAVDAMFVHTDYYFDQHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHI-VKFRTYGWGKTE 169

  Fly   166 EMTNSDSMQYTELKVISNAECAQEY--DVVTSGVICAKGLKDETVCTGDSGGPLVLKDTQIVV-- 226
            ..::|..:|.|.|..:..:|||::|  ..:....|||:.....| |.|||||||    |.||.  
  Fly   170 SRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANT-CNGDSGGPL----TAIVTYD 229

  Fly   227 --------GITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259
                    |:||||.||..:..:   ||.|..:||||.:.:
  Fly   230 HVQMVFQFGVTSFGHADCSKATV---FTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 71/233 (30%)
Tryp_SPc 37..255 CDD:214473 69/230 (30%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 69/230 (30%)
Tryp_SPc 43..266 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.