DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG10764

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:234 Identity:74/234 - (31%)
Similarity:109/234 - (46%) Gaps:45/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LWRKRIL------CGGTLLDKRWILTAGHCTMGVTHYDVY--LGTKSVEDTEVSGGLVLRSNKFI 108
            :|...|.      ||||::..|::|:|.||.  |..||:|  ||.:::.:......::   |.| 
  Fly    50 IWMAAIFNSSDFQCGGTIIHMRFVLSAAHCL--VRGYDLYVRLGARNINEPAAVHTVI---NVF- 108

  Fly   109 VHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAG-----MSVVASGWGAMVEMT 168
            ||..|......|||.|::|.:.:.:|.|:||..:   :......|     .:..|.|||      
  Fly   109 VHHDFIASEYRNDIGLLQLSESIVYTVRVQPICI---FLDPALKGSVEKLKTFRALGWG------ 164

  Fly   169 N-----SDSMQYTELKVISNAECAQEYDV-VTSGVICAKGLKDETVCTGDSGGPL---VL----K 220
            |     |..:|...|..:...||.::.:. :.|..||| |.|:...|.|||||||   :|    |
  Fly   165 NRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICA-GTKNGDTCRGDSGGPLSTNILFPSNK 228

  Fly   221 DTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259
            ..::.:||.|||..   |....|.:|.||.|:|||.|.|
  Fly   229 SYEVQLGIVSFGDP---ECRGVGVYTDVTSYVDWISSTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 72/231 (31%)
Tryp_SPc 37..255 CDD:214473 70/228 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 70/228 (31%)
Tryp_SPc 38..263 CDD:238113 72/231 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.