DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG12133

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:274 Identity:74/274 - (27%)
Similarity:112/274 - (40%) Gaps:45/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TPTDSYAVGQSKYGRIEKFPYQVML-----IGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHY 82
            :|..||.||..: .:..:||:.|:|     ..||  |...:|.|:|:..|::|||.|| :.|..:
  Fly    56 SPPSSYIVGGME-AQSNQFPWTVLLGYEAYTAKQ--RPSPMCAGSLIASRYVLTAAHC-LNVNDF 116

  Fly    83 DVYLGTKSVEDTE-------------------VSGGLVLRSNKFIVHERFNPETAA--NDIALVK 126
            .|........|||                   |...:.||    :.||::......  |||||::
  Fly   117 YVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLR----VPHEQYYTRNGRHYNDIALLR 177

  Fly   127 LPQDVAFTPRIQPASL-PS-RYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQE 189
            |...|.:|.:|:|..: |. ......|.......:|||.......|..::...:..:|..||...
  Fly   178 LKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNR 242

  Fly   190 YD--VVTSGV-ICAKGLKDETVCTGDSGGPLVLK------DTQIVVGITSFGPADGCETNIPGGF 245
            |.  :|...: |||.|........||||.||:..      ....:.||||:|.........|..:
  Fly   243 YPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVY 307

  Fly   246 TRVTHYLDWIESKI 259
            |:.:.|.:||:.||
  Fly   308 TKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 67/257 (26%)
Tryp_SPc 37..255 CDD:214473 65/254 (26%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/265 (26%)
Tryp_SPc 62..317 CDD:214473 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.