DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Jon44E

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:245 Identity:87/245 - (35%)
Similarity:126/245 - (51%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GRIE------------KFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGT 88
            |:||            |.||   ::|.........|||:::|..|:|||.|||....|..:|.|.
  Fly    35 GKIEGRITNGYPAYEGKIPY---IVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGA 96

  Fly    89 KSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPS-RYRHDQFA 152
            ....:.:.: ..|.||: .|.|..:| :...|||||:::|. |.|...:....||| ..|::.::
  Fly    97 SFRHEAQYT-HWVSRSD-MIQHPDWN-DFLNNDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYS 157

  Fly   153 GMSVVASGWGAMVEMTNSDS-----MQYTELKVISNAECAQEY--DVVTSGVICAKGLKDETVCT 210
            |...||||||    :|:::|     :...::::|.|.:|...|  :.:|...||......::.|:
  Fly   158 GWWAVASGWG----LTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCS 218

  Fly   211 GDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260
            |||||||||.|...:|||.|||..:||....|.||||||.|||||....|
  Fly   219 GDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 85/240 (35%)
Tryp_SPc 37..255 CDD:214473 83/237 (35%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 81/233 (35%)
Tryp_SPc 41..266 CDD:238113 83/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
98.970

Return to query results.
Submit another query.