DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and try-9

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:211 Identity:52/211 - (24%)
Similarity:86/211 - (40%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GTLLDKRWILTAGH-----------CTMG-------VTHYDVYLG-----------TKSVEDTEV 96
            |||:....|:||.|           |..|       |..|..::.           .|.:...::
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDM 94

  Fly    97 SGGLVLRS---NKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVA 158
            ...|.::|   .|..|.:......:.||||:.:|.:.:.|:..|.||.|||..:..:........
 Worm    95 FKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKL 159

  Fly   159 SGWGAMVEMTNSDS-MQYTELKVISN--AECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLV-- 218
            .|:|    ...||| ::..:||.:.:  |||:.::..  .||.|...:.....|.||||..:|  
 Worm   160 FGYG----RDPSDSVLESGKLKSLYSFVAECSDDFPY--GGVYCTSAVNRGLSCDGDSGSGVVRT 218

  Fly   219 --LKDTQIVVGITSFG 232
              .::.|::||:.|.|
 Worm   219 SDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 52/211 (25%)
Tryp_SPc 37..255 CDD:214473 52/211 (25%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 52/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.