Sequence 1: | NP_648558.1 | Gene: | CG11529 / 39395 | FlyBaseID: | FBgn0036264 | Length: | 287 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 211 | Identity: | 52/211 - (24%) |
---|---|---|---|
Similarity: | 86/211 - (40%) | Gaps: | 45/211 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 GTLLDKRWILTAGH-----------CTMG-------VTHYDVYLG-----------TKSVEDTEV 96
Fly 97 SGGLVLRS---NKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVA 158
Fly 159 SGWGAMVEMTNSDS-MQYTELKVISN--AECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLV-- 218
Fly 219 --LKDTQIVVGITSFG 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11529 | NP_648558.1 | Tryp_SPc | 37..258 | CDD:238113 | 52/211 (25%) |
Tryp_SPc | 37..255 | CDD:214473 | 52/211 (25%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 52/211 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |