DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG17572

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:228 Identity:64/228 - (28%)
Similarity:97/228 - (42%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGTLLDKRWILTAGHCTMG-----------VTHYDVYLGTKSVEDTEVSGGLVLRS-----NKF 107
            |.|.::.:|.||||.||.:.           |..||    |.|..|...:|....||     :..
  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYD----TSSDPDCANTGFCAPRSVNHAISHV 220

  Fly   108 IVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAM-VEMTNSD 171
            |||..:......:||||:.|...:.::...||..| .:.|.:...|.....:|||.| .......
  Fly   221 IVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL-QKTRANLVVGKRATIAGWGKMSTSSVRQP 284

  Fly   172 SMQYTELKVISNAECAQEYDVVTSGVI-----------CAKGLKDETVCTGDSGGPLVLKDTQIV 225
            .|.:.::.:.|...|.:.|.  ::|.:           ||.| :.:.||.|..|.||.:::..|.
  Fly   285 EMSHLDVPLTSWDLCLRNYG--STGALESPNSIEGQWMCAGG-EGKDVCQGFGGAPLFIQENGIF 346

  Fly   226 --VGITSFGPADGC-ETNIPGGFTRVTHYLDWI 255
              :||.||| :|.| ...||..:|.|.|:.:||
  Fly   347 SQIGIMSFG-SDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 64/228 (28%)
Tryp_SPc 37..255 CDD:214473 62/226 (27%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 64/228 (28%)
Tryp_SPc 138..378 CDD:214473 62/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.