DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:241 Identity:79/241 - (32%)
Similarity:117/241 - (48%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGT- 88
            |:.||..:.      |.||.|.|.....|    .|||:::...|:|||.||........||.|. 
  Fly    38 TNGYAAPEG------KAPYTVGLGFSGGW----WCGGSIIAHDWVLTAEHCIGDAASVIVYFGAT 92

  Fly    89 --KSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPS-RYRHDQ 150
              .:.:.|...|     :..||.|..       .||||:::|. |.|...:....||| ..|::.
  Fly    93 WRTNAQFTHTVG-----NGNFIKHSN-------ADIALIRIPH-VDFWHMVNKVELPSYNDRYNN 144

  Fly   151 FAGMSVVASGWGAMVEMTN-SDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKDETVCTGDSG 214
            :.....||.|||...:.:. .|.:|..:|:::.|.||...|..|...|||.:.:..:::|.||||
  Fly   145 YNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNVICTRTVDGKSICGGDSG 209

  Fly   215 GPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260
            ||||..|...:||:::|..::||::..|.||.|||::||||....|
  Fly   210 GPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 75/225 (33%)
Tryp_SPc 37..255 CDD:214473 73/222 (33%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 76/234 (32%)
Tryp_SPc 37..253 CDD:238113 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.