DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG31954

DIOPT Version :10

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:36 Identity:10/36 - (27%)
Similarity:15/36 - (41%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPLLIRRDSFLILDLSLNIVNSIRTFNLQSDDDLTS 61
            |.|..:.|.|.:|.........:|..:....|:|||
  Fly    13 KELQKQLDEFQMLSAIYCNPGELRVDDYGCIDNLTS 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 6/25 (24%)
CG31954NP_722915.1 Tryp_SPc 51..274 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.