DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and prss60.3

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:238 Identity:90/238 - (37%)
Similarity:121/238 - (50%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGV--THYDVYLGTKS---VEDTEVSGGL 100
            :|:||.|...:....  .|||:|:...|:|||.||..||  |...||||.::   :...|.|..:
Zfish    47 WPWQVSLHSPKYGGH--FCGGSLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQGINIYETSRNV 109

  Fly   101 VLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSR---YRHDQFAGMSVVASGWG 162
            .    |..||..:|..|..|||||::|...|.||..|:|..|.::   |.    ||.|...:|||
Zfish   110 A----KSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYS----AGTSSWITGWG 166

  Fly   163 ---AMVEMTNSDSMQYTELKVISNAEC--AQEYDVVTSGVICA---KGLKDETVCTGDSGGPLV- 218
               |.|.:.....:|.|.:.|::|..|  ......||:.:|||   :|.||  .|.||||||:| 
Zfish   167 DIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGKD--TCQGDSGGPMVT 229

  Fly   219 -LKDTQIVVGITSFGPADGC-ETNIPGGFTRVTHYLDWIESKI 259
             |....:..||||:|  .|| :.|.||.:|||:.|..||.|||
Zfish   230 RLCTVWVQAGITSWG--YGCADPNSPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 87/235 (37%)
Tryp_SPc 37..255 CDD:214473 85/232 (37%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 87/235 (37%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.