DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Hayan

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:244 Identity:71/244 - (29%)
Similarity:114/244 - (46%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIEK--FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMG--VTHYDVYLGTKSVEDTEVS 97
            |:::  :|:...:...........|||:|:..|::|||.||...  .|...|.||..::|:.| .
  Fly   390 RVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPE-P 453

  Fly    98 GGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWG 162
            |...:......:|..::..:...|||:::|.:|...:..|:||.|.:. |.|..|......:|||
  Fly   454 GYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTD-RSDPPANYKYFVAGWG 517

  Fly   163 AMVEMTN---SDSMQYTELKVISNAECAQEY------------DVVTSGVICAKGLKDETVCTGD 212
            .| .:||   |..:....|.::...||...:            .|:.|.:..|...:.:..|.||
  Fly   518 VM-NVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGD 581

  Fly   213 SGGPLVLK-----DTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIE 256
            |||||:|:     .|..:||:.|.|  .||.|..||.:|||:.:||:||
  Fly   582 SGGPLILEIDDVDGTYSIVGVISSG--FGCATKTPGLYTRVSSFLDYIE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 71/244 (29%)
Tryp_SPc 37..255 CDD:214473 69/241 (29%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 69/241 (29%)
Tryp_SPc 385..630 CDD:238113 71/244 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.