DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG31220

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:121/292 - (41%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRIL----------CGGTLLDKRWILTAGHC 75
            ||..|:....|...  .:.::|:..||    |:|.|..          |||:|::.|::|||.||
  Fly    97 KPQTTNRVIGGTEP--NLNEYPWLAML----LYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHC 155

  Fly    76 TMGVTH-----YDVYLG--TKSVEDTEVSGG---------LVLRSNKFIVHERFNPE--TAANDI 122
               ||.     ..|.||  |.|.....:|.|         |.:.......|..::|.  |..|||
  Fly   156 ---VTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDI 217

  Fly   123 ALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWG--AMVEMTNSDSMQYTELKVISNAE 185
            |||:|.:.|.:|....|..:....|  ......:..:|||  .|.: |.|..:::..:||....|
  Fly   218 ALVRLKEPVRYTMAYYPICVLDYPR--SLMKFKMYVAGWGKTGMFD-TGSKVLKHAAVKVRKPEE 279

  Fly   186 CAQEYDVVTSG---VICAKGLKDETVCTGDSGGPLV------LKDTQIVVGITSFGPADGCET-N 240
            |:::|.....|   .|||.||.:...|.||||.||:      .:....:.||||:|  ..|.| .
  Fly   280 CSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYG--GPCGTIG 342

  Fly   241 IPGGFTRVTHYLDWIESKIGSHGQVHQQYLRP 272
            .|..|||...:..||.:           :|||
  Fly   343 WPSVFTRTAKFYKWIRA-----------HLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 77/260 (30%)
Tryp_SPc 37..255 CDD:214473 75/257 (29%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 76/267 (28%)
Tryp_SPc 104..360 CDD:238113 78/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.