DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and ctrb.1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:251 Identity:77/251 - (30%)
Similarity:121/251 - (48%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYL 86
            |..|....:...:..|...:|:||.|.....:.   .|||:|:::.|::||.||.:..:| .|.|
Zfish    26 PVVTGYARIVNGEEARPHSWPWQVSLQDSTGFH---FCGGSLINENWVVTAAHCNVRTSH-RVIL 86

  Fly    87 GTKSVEDTEVSGGLVLRS---NKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRH 148
            |    |....|....:::   .|.|.|..:|..|..|||.|:||.........:.|..|..  .:
Zfish    87 G----EHDRSSNAEAIQTIAVGKSIKHPNYNSFTINNDILLIKLATPAKINTHVSPVCLAE--TN 145

  Fly   149 DQF-AGMSVVASGWGAMVEMTNSDS---MQYTELKVISNAECAQEYDV-VTSGVICAKGLKDETV 208
            |.| .||..|.|||| :......|:   :|...|.:::|.:|.:.:.. :|..:||| |....:.
Zfish   146 DNFPGGMKCVTSGWG-LTRYNAPDTPALLQQAALPLLTNDDCKRYWGTNITDLMICA-GASGVSS 208

  Fly   209 CTGDSGGPLVLKDTQI--VVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSH 262
            |.||||||||.::.::  :|||.|:| :..|.|:.|..:.|||....|::..|.|:
Zfish   209 CMGDSGGPLVCENNRVWTLVGIVSWG-SSTCSTSTPAVYARVTKLRAWVDQTIASN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/230 (32%)
Tryp_SPc 37..255 CDD:214473 72/227 (32%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 72/235 (31%)
Tryp_SPc 34..259 CDD:238113 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.