DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and spirit

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:244 Identity:82/244 - (33%)
Similarity:121/244 - (49%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIEKFPYQVMLIGKQLWRKRIL--CGGTLLDKRWILTAGHCT--MGVTHYDVYLGTKSVEDTEVS 97
            |..:||:...|..:..:.:||.  |||.|:...::|||.||.  .|.....|.||..::..||  
  Fly   139 RPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTE-- 201

  Fly    98 GGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWG 162
             |..:...:.|:|..::..||.|||||::|  :.|..|.::|..:   :...:.....|.|.|:|
  Fly   202 -GEDISIRRVIIHPDYSASTAYNDIALLEL--ETAAKPELKPTCI---WTQKEVTNTLVTAIGYG 260

  Fly   163 AMVEMTNSDSMQYTE--LKVISNAECAQEY--DVVTSGVI----CAKGLKDE-TVCTGDSGGPLV 218
             ........|.|..:  ||.:||.||...|  |.:..||:    ||..:..| ..|.|||||||:
  Fly   261 -QTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLL 324

  Fly   219 LKDTQI--VVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIGSHGQV 265
            ::|..:  ||||||.|  .||.:..|..:|||:.::||||..:....||
  Fly   325 MQDGLLGYVVGITSLG--QGCASGPPSVYTRVSSFVDWIEGIVWPAQQV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 80/235 (34%)
Tryp_SPc 37..255 CDD:214473 77/232 (33%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 80/235 (34%)
Tryp_SPc 132..361 CDD:214473 77/232 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.