DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:279 Identity:80/279 - (28%)
Similarity:118/279 - (42%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPYQ-------VMLIGKQLWRKRILCGGTLLDK 66
            ||.|..::|        .|.|..:...|.:|..|:.       .::..|.|   |::|||.|:.:
  Rat     4 LLFLMALLL--------PSGAGAEEIIGGVESIPHSRPYMAHLDIVTEKGL---RVICGGFLISR 57

  Fly    67 RWILTAGHCT-MGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQD 130
            :::|||.||. ..:|   |.||...|...| |....::..|.|:||.:|.....:||.|:||.:.
  Rat    58 QFVLTAAHCKGREIT---VILGAHDVRKRE-STQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKK 118

  Fly   131 VAFTPRIQ--PASLPSRYRHDQFAGMSVVASGWGAM-VEMTNSDSMQYTELKVISNAECAQ---- 188
            |..||.:.  |...||.:.|   .|....|:|||.. |....|.:::..||:::....|..    
  Rat   119 VELTPAVNVVPLPSPSDFIH---PGAMCWAAGWGKTGVRDPTSYTLREVELRIMDEKACVDYRYY 180

  Fly   189 EYDVVTSGVICAKGLKDETVCT-----------GDSGGPLVLKDTQIVVGITSFGPADGCETNIP 242
            ||..              .||.           |||||||:.  ..:..||.|:|..|   ...|
  Rat   181 EYKF--------------QVCVGSPTTLRAAFMGDSGGPLLC--AGVAHGIVSYGHPD---AKPP 226

  Fly   243 GGFTRVTHYLDWIESKIGS 261
            ..||||:.|:.||.:.|.:
  Rat   227 AIFTRVSTYVPWINAVINT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 72/246 (29%)
Tryp_SPc 37..255 CDD:214473 70/243 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 71/247 (29%)
Tryp_SPc 21..242 CDD:238113 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.