DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Prss27

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:302 Identity:83/302 - (27%)
Similarity:127/302 - (42%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HLLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPYQV----MLIGKQLWRKRI------LCGGT 62
            |:..|.::.|::...|   ..|......|....|...|    .|.|:..|:..|      .|||:
  Rat     5 HITALLLLPLLLRSGT---EGAEAMRACGHPRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGS 66

  Fly    63 LLDKRWILTAGHC---TMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIAL 124
            |:...|:|||.||   |..::.|.|.||...::... ...|.:...:...|..:....::.|:||
  Rat    67 LIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQPG-PHALYVPVKRVKSHPEYQGMASSADVAL 130

  Fly   125 VKLPQDVAFTPRIQPASLPSR---YRHDQFAGMSVVASGWGAMVE---MTNSDSMQYTELKVISN 183
            |:|...|.||..|.|..||..   ::    :||:...:|||:..|   :.|...:|...:.:|..
  Rat   131 VELQVPVTFTKYILPVCLPDPSVVFK----SGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDT 191

  Fly   184 AECAQEYD----------VVTSGVIC---AKGLKDETVCTGDSGGPLV--LKDTQIVVGITSFGP 233
            .:|...|.          .:...::|   |:|.||  .|.||||||||  :..:.:..|:.|:| 
  Rat   192 PKCNLLYSKDAEADIQLKTIKDDMLCAGFAEGKKD--ACKGDSGGPLVCLVDQSWVQAGVISWG- 253

  Fly   234 ADGC-ETNIPGGFTRVTHYLDWIESKI------GSHGQVHQQ 268
             :|| ..|.||.:.||..:..||...|      |..|...||
  Rat   254 -EGCARRNRPGVYIRVASHYQWIHQIIPELQFQGRAGSQQQQ 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 72/255 (28%)
Tryp_SPc 37..255 CDD:214473 70/252 (28%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 69/246 (28%)
Tryp_SPc 39..278 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.