DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Prss30

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:243 Identity:77/243 - (31%)
Similarity:123/243 - (50%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHC---TMGVTHYDVYLGTKSVEDTEVSGGLV 101
            ::|:||.|   :..::..:|||:|:.:.|:|||.||   .:..:.|.|.:|..::..||....||
  Rat    41 RWPWQVSL---RTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLSLTEPHSTLV 102

  Fly   102 LRSNKFIVHERFNPETAANDIALVKLPQDVAFTP-RIQPASLPSRYRHDQFAGMSVVASGWGAMV 165
            ...|.|:.......:.::.||||::|  |....| :..|..|| :.:.....|.....:||||..
  Rat   103 AVRNIFVYPTYLWEDASSGDIALLRL--DTPLQPSQFSPVCLP-QAQAPLTPGTVCWVTGWGATH 164

  Fly   166 EMTNSDSMQYTELKVISNAECAQEYD----------VVTSGVICA---KGLKDETVCTGDSGGPL 217
            |...:..:|...:.::.:.:|.:.|.          |:.|.::||   :|.||.  |.|||||||
  Rat   165 ERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDS--CQGDSGGPL 227

  Fly   218 V--LKDTQIVVGITSFGPADGC-ETNIPGGFTRVTHYLDWIESKIGSH 262
            |  :..:.|.|||||:|  .|| ..|.||.:|||..|:|||:..:..:
  Rat   228 VCAINSSWIQVGITSWG--IGCARPNKPGVYTRVPDYVDWIQRTLAEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 77/237 (32%)
Tryp_SPc 37..255 CDD:214473 75/234 (32%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.