DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG18420

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:68/282 - (24%)
Similarity:126/282 - (44%) Gaps:57/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLAVIMLMMWKPTPTDSYAVGQSKYGRIEKFPYQVMLIGKQL------------W-------R 54
            ::|:|.|:|::     |....:|.:::...|......:.:|.::            |       .
  Fly     5 VIGMASILLLL-----TVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSS 64

  Fly    55 KRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKS------VEDTEVSGGLVLRSNKFIVHERF 113
            .:.:|||||:.:|.:|||.||.:..|...|.||..:      .|:.:|        |:...|..:
  Fly    65 NQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQV--------NRTFQHRFY 121

  Fly   114 NPETAANDIALVKLPQDVAFTPRIQPASL--PSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYT 176
            :|.|.||||||::|..:|.:...|:|..:  .:.::|...:...:..:|||....|.:|..::..
  Fly   122 DPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTL 186

  Fly   177 ELKVISNAECAQEYDVVTSGVICAKGLKDETVCTGDSGGPL--------VLKDTQIVVGITSFGP 233
            ::....:..||  :..|.|...|| |..:..:|.||:|||:        ..:..|:.:.||:   
  Fly   187 DISRQPSKMCA--FGSVLSNQFCA-GNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITN--- 245

  Fly   234 ADGCETNIPGGFTRVTHYLDWI 255
             ..|:.  |..||.|..::::|
  Fly   246 -KRCQR--PSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 62/254 (24%)
Tryp_SPc 37..255 CDD:214473 61/252 (24%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 59/238 (25%)
Tryp_SPc 43..267 CDD:238113 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.