DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG18636

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:251 Identity:68/251 - (27%)
Similarity:112/251 - (44%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLG---- 87
            :|.:......:....|:.|.|   .......:|||:|:..:.:|||.||.:...|....||    
  Fly    42 AYRIINGHTAKYNSSPWMVFL---HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYER 103

  Fly    88 TKSVEDT----------EVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASL 142
            |:|.|.|          .|..|        ..|:.::|.|.|||||:::|.:.|.:...|:|..:
  Fly   104 TRSEECTGYYCNFREEHMVDAG--------FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV 160

  Fly   143 --PSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSGVICAKGLKD 205
              ..|:||.......:.|:|||.....::||::|..:::......||:......:|.....|..|
  Fly   161 VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD 225

  Fly   206 ETVCTGDSGGPL----VLKDTQ--IVVGITSFGPADGCETNIPGGFTRVTHYLDWI 255
            ..:|.|||||||    ..|:||  :.|||.|:...:..:.::   ||.|..:.::|
  Fly   226 SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASV---FTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 67/241 (28%)
Tryp_SPc 37..255 CDD:214473 66/239 (28%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/247 (27%)
Tryp_SPc 45..278 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.