DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and Tpsg1

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:259 Identity:78/259 - (30%)
Similarity:118/259 - (45%) Gaps:60/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 FPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTH---YDVYLGTKSVEDTEVSGGLVL 102
            :|:|..|   :|.:..: |||:||...|:|||.||..|..:   |.|:||..:          |.
Mouse    98 WPWQASL---RLHKVHV-CGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELT----------VT 148

  Fly   103 RSNKFIVHERF-------NPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASG 160
            .|..|...:|.       .|..::.|||||:|...||.:.::||..||.. ..|.:.||....:|
Mouse   149 LSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEA-SADFYPGMQCWVTG 212

  Fly   161 WGAMVE---MTNSDSMQYTELKVISNAECAQEYD-----VVTSGVICAKGLKDETVCTGDSGGPL 217
            ||...|   :....::|..::.|:....|:|.|:     ::...::||:|..|  .|..||||||
Mouse   213 WGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARGPGD--ACQDDSGGPL 275

  Fly   218 V--LKDTQIVVGITSFGPADGC-ETNIPGGFTRVTHYLDWIESKIGSHGQVHQQYLRPQQQHHH 278
            |  :..|....|:.|:|  :|| ..:.||.:.|||.|::||                    |||
Mouse   276 VCQVAGTWQQAGVVSWG--EGCGRPDRPGVYARVTAYVNWI--------------------HHH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 75/237 (32%)
Tryp_SPc 37..255 CDD:214473 73/234 (31%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.