DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG30286

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:285 Identity:73/285 - (25%)
Similarity:122/285 - (42%) Gaps:50/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LAVIMLMMWKPTPTDSYAVGQSKY------------GRIEKFPYQVMLIGKQLWRK--RILCGGT 62
            |.:..|:.|.|..|..:......|            ..|.:.|:...|      .|  .::||||
  Fly     5 LLLTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYL------HKSGELVCGGT 63

  Fly    63 LLDKRWILTAGHCTMGVTHYDVYLGT-KSVEDTEVSGGLVL-RSNKFIV-----HERFNPETAAN 120
            |::.|:||||.||.....:..|.||. .|:...:.:|...| .|..|.:     |..::.....:
  Fly    64 LVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIH 128

  Fly   121 DIALVKLPQDVAFTPRIQPASL-------PSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTEL 178
            ||.|::|.:.|.:...|:|..|       |...|..:     :||:|||.......:..::...:
  Fly   129 DIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHR-----LVATGWGRSPSEAANHILKSIRV 188

  Fly   179 KVISNAECAQEYDV-VTSGVICAKGLKDETVCTGDSGGPL---VLKDTQIV---VGITSFGPADG 236
            ..::...|::.|.| .....||... :....|:||||||:   :..|.:::   |||.|:|.|: 
  Fly   189 TRVNWGVCSKTYWVDRRRDQICVSH-ESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAE- 251

  Fly   237 CETNIPGGFTRVTHYLDWIESKIGS 261
            |.:  |..||.|..::|||.:.:.:
  Fly   252 CLS--PSVFTNVMEHIDWIMAALST 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 67/243 (28%)
Tryp_SPc 37..255 CDD:214473 65/240 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 66/244 (27%)
Tryp_SPc 39..268 CDD:214473 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.