DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11529 and CG30087

DIOPT Version :9

Sequence 1:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:252 Identity:79/252 - (31%)
Similarity:114/252 - (45%) Gaps:49/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYLGTKSVE-D 93
            |...|...|...|:.|.:....|..    |||::|:.|:||||.||..  .:..:.||..::. |
  Fly    42 VVNGKEAVIRSAPFMVYVTNNSLTH----CGGSILNSRYILTAAHCVF--PNLRLRLGEHNIRTD 100

  Fly    94 TEVSGGLVLRSN-----------KFIVHERFNPETAANDIALVKLPQDVAFTPRIQ-------PA 140
            .:..|     ||           |.|.|..:|.....|||||:||.:.:.|...||       ||
  Fly   101 PDCQG-----SNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPA 160

  Fly   141 SLPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEYDVVTSG-VICAKGLK 204
            |.||...:..|        |||...:......:|..||:....|.|::.:....:| .||| |.:
  Fly   161 SAPSVATYQTF--------GWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICA-GHE 216

  Fly   205 DETVCTGDSGGPLVLK------DTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWI 255
            :...|.||||||||.:      ...:.:||.|:||.| |::  ||.:|.|.:|::||
  Fly   217 ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTD-CQS--PGVYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 77/245 (31%)
Tryp_SPc 37..255 CDD:214473 75/243 (31%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/250 (31%)
Tryp_SPc 42..272 CDD:238113 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.